Human TNFR (His) Protein
Recombinant of human TNFR (His) protein
Product Specifications
Product Name Alternative
Tumor necrosis factor receptor superfamily member 1A, Tumor necrosis factor receptor 1, Tumor necrosis factor receptor type I, TNF-R1, TNF-RI, TNFR-I, p60, p55, CD120a, TNFRSF1A, TNFAR, TNFR1, FPF, TBP1, TNF-R, p55-R, TNFR55, TNFR60, TNF-R-I, TNF-R55, MGC19588.
Source
Escherichia Coli
Purity
Greater than 95.0% as determined by SDS-PAGE.
Form
Sterile Filtered clear solution.
Storage Conditions
Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles
Notes
For research use only.
Applications Notes
Cytokines And Growth Factors
Preservative
TNFR His Tag protein is supplied in 1xPBS, 50% glycerol.
AA Sequence
DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
