Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TPO Protein

Recombinant of Human TPO protein

Product Specifications

Product Name Alternative

Megakaryocyte colony-stimulating factor, Myeloproliferative leukemia virus oncogene ligand, C-mpl ligand, ML, Megakaryocyte growth and development factor, MGDF, TPO, MKCSF, MPLLG, MGC163194, THPO.

Source

HEK

Purity

Greater than 95% as obsereved by SDS-PAGE.

Bioactivity

The activity was determined by the dose-dependent stimulation of the proliferation of MO7e cells, the ED50 is 1.15ng/ml.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized Thrombopoietin in sterile PBS containing 0.1% endotoxin-free recombinant HSA.

Storage Conditions

Stability: Lyophilized Thrombopoietin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TPO should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

The TPO protein was filtered (0.2μm) and lyophilized from 0.74mg/ml in 1xPBS.

AA Sequence

SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLG EWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQV RLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGG STLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLK WQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAP DISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPT PTSPLLNTSYTHSQNLSQEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FroggaBio LITE 50uL Pipette
FBP-50 1 Unit

FroggaBio LITE 50uL Pipette

Sign In for Pricing
View Details
Anti-Human LGR4/GPR48 Recombinant Antibody (SAA2706)
HV980207 100 µg

Anti-Human LGR4/GPR48 Recombinant Antibody (SAA2706)

Sign In for Pricing
View Details
Anti-PDCD4 Antibody Picoband® Fluoro594 Conjugated
A01105-3-Fluoro594 100 µg/Vial

Anti-PDCD4 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
MRX27 siRNA Oligos set (Human)
30651171 3x 5 nmol

MRX27 siRNA Oligos set (Human)

Sign In for Pricing
View Details
MRPS36-set siRNA/shRNA/RNAi Lentivector (Human)
30591091 4x 500 ng

MRPS36-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Bovine Hepatic lipase (HL) ELISA Kit
OM620852 96 Strip Well

Bovine Hepatic lipase (HL) ELISA Kit

Sign In for Pricing
View Details