What is the catalog number for Human VEGFC (HEK) Protein?

The catalog number for Human VEGFC (HEK) Protein is orb429198.

What sizes are available for Human VEGFC (HEK) Protein?

Human VEGFC (HEK) Protein is available in the following size(s): 5 µg, 20 µg, 1 mg.

How many pack sizes does Human VEGFC (HEK) Protein come in?

Human VEGFC (HEK) Protein is available in 3 different pack sizes.

Is Human VEGFC (HEK) Protein in stock?

Human VEGFC (HEK) Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human VEGFC (HEK) Protein

Recombinant of human VEGFC (HEK) protein

Product Specifications

Product Name Alternative

VEGF-C, Vascular endothelial growth factor C, VRP, Flt4 ligand, Flt4-L, Vascular endothelial growth factor-related protein, VEGFC.

Source

HEK293 cells

Field of Research

Cardiovascular Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized VEGFC in 1xPBS to a concentration no less than 100 μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized VEGFC although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGFC should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

VEGFC was lyophilized from a 0.2 μM filtered solution of 20mM Tris-HCl and 150mM NaCl, pH 7.2.

AA Sequence

FESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRVDHHHHHH