Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF C Protein

Recombinant of VEGF C protein

Product Specifications

Product Name Alternative

VEGF-C, Vascular endothelial growth factor C, VRP, Flt4 ligand, Flt4-L.

Source

Sf9, Insect Cells

Field of Research

Cardiovascular Research; Cell Biology

Purity

Greater than 90.0% as determined by SDS-PAGE.

Bioactivity

Measured by its ability to stimulate phosphorylation of the VEGFR-3/FLT-4 receptor in porcine aortic endothelial cells. The ED50 for this effect is typically 200-300ng/ml corresponding to a Specific Activity of 3,334-5,000IU/mg.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized Vascular Endothelial Growth Factor C in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized Vascular Endothelial Growth Factor-C although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGF-C should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

Each mg of VEGF-C Rat contains 50mg rAlbumin and PBS as buffer.

AA Sequence

DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFA NHTSCRCMSKLDVYRQVHSIIHHHHHH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,1'-(1-Cyclobutene-1,2-diyl)bis-benzene
TRC-C990325-25MG 25 mg

1,1'-(1-Cyclobutene-1,2-diyl)bis-benzene

Sign In for Pricing
View Details
Horse Calpain, Small Subunit 1 ELISA Kit
MBS068465-01 48 Well

Horse Calpain, Small Subunit 1 ELISA Kit

Sign In for Pricing
View Details
Horse Calpain, Small Subunit 1 ELISA Kit
MBS068465-02 96 Well

Horse Calpain, Small Subunit 1 ELISA Kit

Sign In for Pricing
View Details
Horse Calpain, Small Subunit 1 ELISA Kit
MBS068465-03 5x 96 Well

Horse Calpain, Small Subunit 1 ELISA Kit

Sign In for Pricing
View Details
Horse Calpain, Small Subunit 1 ELISA Kit
MBS068465-04 10x 96 Well

Horse Calpain, Small Subunit 1 ELISA Kit

Sign In for Pricing
View Details
GRIA2/GRIA3 Antibody
orb572590-01 50 μL

GRIA2/GRIA3 Antibody

Sign In for Pricing
View Details