Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF C Protein

Recombinant of VEGF C protein

Product Specifications

Product Name Alternative

VEGF-C, Vascular endothelial growth factor C, VRP, Flt4 ligand, Flt4-L.

Source

Sf9, Insect Cells

Field of Research

Cardiovascular Research; Cell Biology

Purity

Greater than 90.0% as determined by SDS-PAGE.

Bioactivity

Measured by its ability to stimulate phosphorylation of the VEGFR-3/FLT-4 receptor in porcine aortic endothelial cells. The ED50 for this effect is typically 200-300ng/ml corresponding to a Specific Activity of 3,334-5,000IU/mg.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized Vascular Endothelial Growth Factor C in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized Vascular Endothelial Growth Factor-C although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGF-C should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

Each mg of VEGF-C Rat contains 50mg rAlbumin and PBS as buffer.

AA Sequence

DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFA NHTSCRCMSKLDVYRQVHSIIHHHHHH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phthalic Acid-d4 Mono-tetrahydrogeranyl Ester
sc-477521 5 mg

Phthalic Acid-d4 Mono-tetrahydrogeranyl Ester

Sign In for Pricing
View Details
Zebrafish LHCGR Rabbit Polyclonal Antibody (FITC)
orb2938469 100 µg

Zebrafish LHCGR Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Volumetric flask. TPX, Class B, 1000 ml - ABDOS
P50106 1 Unit/Pack

Volumetric flask. TPX, Class B, 1000 ml - ABDOS

Sign In for Pricing
View Details
1- (2-Methylpropyl) -2,5-dihydro-1H-1,2,3,4-tetrazole-5-thione
HAA62434-01 250 mg

1- (2-Methylpropyl) -2,5-dihydro-1H-1,2,3,4-tetrazole-5-thione

Sign In for Pricing
View Details
1- (2-Methylpropyl) -2,5-dihydro-1H-1,2,3,4-tetrazole-5-thione
HAA62434-02 2.5 g

1- (2-Methylpropyl) -2,5-dihydro-1H-1,2,3,4-tetrazole-5-thione

Sign In for Pricing
View Details
STAG2 siRNA (Human)
CRH7314-01 15 nmol

STAG2 siRNA (Human)

Sign In for Pricing
View Details