Human Fractalkine Protein
Recombinant of human Fractalkine protein
Product Specifications
Product Name Alternative
Fractalkine, CX3CL1, Neurotactin, CX3C membrane-anchored chemokine, Small inducible cytokine D1, NTN, NTT, CXC3, CXC3C, SCYD1, ABCD-3, C3Xkine.
Source
Escherichia Coli
Field of Research
Immunology & Inflammation
Purity
Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Bioactivity
The Biological activity is calculated by its ability to chemoattract human T-Lymphocytes using a concentration range of 5.0-10.0 ng/ml corresponding to a Specific Activity of 100,000-200,000IU/mg.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized CX3CL1 in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Storage Conditions
Stability: Lyophilized CX3CL1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CX3CL1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles
Notes
For research use only.
Applications Notes
Chemokines
Preservative
The CX3CL1 was lyophilized from a 0.2μm filtered concentrated (1.0 mg/ml) solution in 20mM Phosphate buffer, pH 7.4, 50mM NaCl.
AA Sequence
QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQW VKDAMQHLDRQAAALTRNG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![N1,N3,N5-Tris[3-(Didodecylamino)propyl]-1,3,5-benzenetricarboxamide-D18](https://cdn.genprice.uk/products/572/12096984/imageurl/trc-d458951-10mg.webp)
TRC-D458951-10MG 10 mg
N1,N3,N5-Tris[3-(Didodecylamino)propyl]-1,3,5-benzenetricarboxamide-D18
Sign In for Pricing
View Details 
BNC040636-100 1x 100 µL
Human Lambda Light Chain (LAM03), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB0099-500 1x 500 µL
Human Nuclear Antigen (235-1), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 