Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HCC 1 Protein

Recombinant of human HCC 1 protein

Product Specifications

Product Name Alternative

Small inducible cytokine A14, CCL14, Chemokine CC-1/CC-3, HCC-1/HCC-3, HCC-1 (1-74), NCC-2, chemokine (C-C motif) ligand 14, CC-1, CC-3, CKb1, MCIF, SY14, HCC-1, HCC-3, SCYL2, SCYA14.

Source

Escherichia Coli

Field of Research

Signal Transduction

Purity

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Bioactivity

The Biological activity is calculated by its ability to chemoattract Human monocytes at 5-20ng/ml corresponding to a Specific Activity of 50,000-200,000IU/mg.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized HCC-1 in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized HCC1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL14 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Chemokines

Preservative

The CCL14 protein was lyophilized with 20mM PBS pH-7.4 and 150mM NaCl.

AA Sequence

TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM149 CRISPRa sgRNA lentivector (set of three targets)(Human)
46906121 3x 1.0µg DNA

TMEM149 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Myoglobin (MYO) antibody
E35D1060 100 µL

Myoglobin (MYO) antibody

Sign In for Pricing
View Details
NOXA1 polyclonal antibody
BS75488-01 50 µL

NOXA1 polyclonal antibody

Sign In for Pricing
View Details
NOXA1 polyclonal antibody
BS75488-02 100 µL

NOXA1 polyclonal antibody

Sign In for Pricing
View Details
HIST1H2BD Antibody, HRP conjugated
CSB-PA010404LB01HU-01 50 µg

HIST1H2BD Antibody, HRP conjugated

Sign In for Pricing
View Details
HIST1H2BD Antibody, HRP conjugated
CSB-PA010404LB01HU-02 100 µg

HIST1H2BD Antibody, HRP conjugated

Sign In for Pricing
View Details