Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HCC 1 Protein

Recombinant of human HCC 1 protein

Product Specifications

Product Name Alternative

Small inducible cytokine A14, CCL14, Chemokine CC-1/CC-3, HCC-1/HCC-3, HCC-1 (1-74), NCC-2, chemokine (C-C motif) ligand 14, CC-1, CC-3, CKb1, MCIF, SY14, HCC-1, HCC-3, SCYL2, SCYA14.

Source

Escherichia Coli

Field of Research

Signal Transduction

Purity

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Bioactivity

The Biological activity is calculated by its ability to chemoattract Human monocytes at 5-20ng/ml corresponding to a Specific Activity of 50,000-200,000IU/mg.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized HCC-1 in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized HCC1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL14 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Chemokines

Preservative

The CCL14 protein was lyophilized with 20mM PBS pH-7.4 and 150mM NaCl.

AA Sequence

TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS6KA2-IT1 Protein Vector (Human) (pPM-C-HA)
PV126832 500 ng

RPS6KA2-IT1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
ARL2BP sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
12377111 3x 1.0 µg

ARL2BP sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
IGF2 ELISA Kit (Rabbit)
OKCD01445-96W 96 Well

IGF2 ELISA Kit (Rabbit)

Sign In for Pricing
View Details
2-Amino-6-thiocyanatobenzothiazole
sc-229927 25 g

2-Amino-6-thiocyanatobenzothiazole

Sign In for Pricing
View Details
GAPDH Polyclonal Antibody, Cy5.5 Conjugated
bs-41373R-Cy5.5 100 µL

GAPDH Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
TRIM62, CT (TRIM62, Tripartite motif-containing protein 62) (MaxLight 405)
MBS6358533-01 0.1 mL

TRIM62, CT (TRIM62, Tripartite motif-containing protein 62) (MaxLight 405)

Sign In for Pricing
View Details