Human I TAC Protein
Recombinant of human I TAC protein
Product Specifications
Product Name Alternative
Small inducible cytokine B11, CXCL11, I-TAC, IP-9, H174, Beta-R1, chemokine (C-X-C motif) ligand 11, IP9, b-R1, SCYB11, SCYB9B, MGC102770.
Source
Escherichia Coli
Field of Research
Neuroscience
Purity
Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Bioactivity
Determined by its ability to chemoattract human IL-2 activated T-Lymphocytes using a concentration range of 0.1-10.0 ng/ml.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized I-TAC in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Storage Conditions
Stability: Lyophilized I-TAC although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution I-TAC should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles
Notes
For research use only.
Applications Notes
Chemokines
Preservative
Lyophilized from a 0.2?m filtered concentrated (0.5mg/ml) solution in 20mM PB, pH 7.4, 100mM NaCl.
AA Sequence
FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PE/Cyanine5.5 Anti-Mouse MHC II (I-A/I-E) Antibody[M5/114]](https://cdn.genprice.uk/products/763/68dd14af061270361e7d38bd/imageurl/e-ab-f0990i.webp)
E-AB-F0990I-01 50 Tests
PE/Cyanine5.5 Anti-Mouse MHC II (I-A/I-E) Antibody[M5/114]
Sign In for Pricing
View Details E-AB-F0990I-02 100 Tests
PE/Cyanine5.5 Anti-Mouse MHC II (I-A/I-E) Antibody[M5/114]
Sign In for Pricing
View Details E-AB-F0990I-03 2x 100 Tests
PE/Cyanine5.5 Anti-Mouse MHC II (I-A/I-E) Antibody[M5/114]
Sign In for Pricing
View Details