Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human I TAC Protein

Recombinant of human I TAC protein

Product Specifications

Product Name Alternative

Small inducible cytokine B11, CXCL11, I-TAC, IP-9, H174, Beta-R1, chemokine (C-X-C motif) ligand 11, IP9, b-R1, SCYB11, SCYB9B, MGC102770.

Source

Escherichia Coli

Field of Research

Neuroscience

Purity

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Bioactivity

Determined by its ability to chemoattract human IL-2 activated T-Lymphocytes using a concentration range of 0.1-10.0 ng/ml.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized I-TAC in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized I-TAC although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution I-TAC should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Chemokines

Preservative

Lyophilized from a 0.2?m filtered concentrated (0.5mg/ml) solution in 20mM PB, pH 7.4, 100mM NaCl.

AA Sequence

FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

16, (5α) -ANDROSTEN-3-ONE-3-CARBOXYMETHYLOXIME : BSA
502762 Inquire

16, (5α) -ANDROSTEN-3-ONE-3-CARBOXYMETHYLOXIME : BSA

Sign In for Pricing
View Details
SLC6A18 antibody
70R-1802 100 µL

SLC6A18 antibody

Sign In for Pricing
View Details
CACNG3 (Voltage-dependent Calcium Channel gamma-3 Subunit, Calcium Channel, Voltage-dependent, gamma Subunit 3)
476973 100 µL

CACNG3 (Voltage-dependent Calcium Channel gamma-3 Subunit, Calcium Channel, Voltage-dependent, gamma Subunit 3)

Sign In for Pricing
View Details
Anti-COP Zeta 1 (I48) COPZ1 Antibody
A07977-1 100 µL

Anti-COP Zeta 1 (I48) COPZ1 Antibody

Sign In for Pricing
View Details
Human αFP Antibody Pair Set
E-KAB-0070 50 µL & 100 µg

Human αFP Antibody Pair Set

Sign In for Pricing
View Details
Human Anti-IL6 autoantibody ELISA Kit
MBS2801834-01 48 Tests

Human Anti-IL6 autoantibody ELISA Kit

Sign In for Pricing
View Details