Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MCP 4 Protein

Recombinant of human CCL13 protein

Product Specifications

Product Name Alternative

Small inducible cytokine A13, CCL13, Monocyte chemotactic protein 4, MCP-4, Monocyte chemoattractant protein 4, CK-beta-10, NCC-1, chemokine (C-C motif) ligand 13, NCC1, CKb10, SCYL1, SCYA13, MGC17134.

Source

Escherichia Coli

Purity

Greater than 96.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Bioactivity

The specific activity as determined by the ability of MCP-4 to chemoattaract human monocytes at 10-100ng/ml, corresponding to a Specific Activity of 10,000-100,000 units/mg.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized MCP-4 in sterile 18M-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized MCP-4 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MCP-4 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Chemokines

Preservative

The protein was lyophilized from a concentrated (1mg/ml) sterile solution in 20mM PB, pH 7.4, 130mM NaCl.

AA Sequence

QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAD2L1BP (CMT2, KIAA0110, MAD2L1-binding Protein, Caught by MAD2 Protein) (MaxLight 405)
MBS6384559-01 0.1 mL

MAD2L1BP (CMT2, KIAA0110, MAD2L1-binding Protein, Caught by MAD2 Protein) (MaxLight 405)

Sign In for Pricing
View Details
MAD2L1BP (CMT2, KIAA0110, MAD2L1-binding Protein, Caught by MAD2 Protein) (MaxLight 405)
MBS6384559-02 5x 0.1 mL

MAD2L1BP (CMT2, KIAA0110, MAD2L1-binding Protein, Caught by MAD2 Protein) (MaxLight 405)

Sign In for Pricing
View Details
OKAG01893-2X96W - Phospho-BAD (Ser136) Colorimetric Cell-Based ELISA Kit
OKAG01893-2X96W 2x 96 Well Plates

OKAG01893-2X96W - Phospho-BAD (Ser136) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
IQCG Adenovirus (Rat)
25058056 1.0 mL

IQCG Adenovirus (Rat)

Sign In for Pricing
View Details
Cystathionase antibody
70R-1253 100 µL

Cystathionase antibody

Sign In for Pricing
View Details
Monoclonal Antibody to Procollagen I N-Terminal Propeptide (PINP)
TRV-0035156-01 20 µL

Monoclonal Antibody to Procollagen I N-Terminal Propeptide (PINP)

Sign In for Pricing
View Details