Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MCP 4 Protein

Recombinant of human CCL13 protein

Product Specifications

Product Name Alternative

Small inducible cytokine A13, CCL13, Monocyte chemotactic protein 4, MCP-4, Monocyte chemoattractant protein 4, CK-beta-10, NCC-1, chemokine (C-C motif) ligand 13, NCC1, CKb10, SCYL1, SCYA13, MGC17134.

Source

Escherichia Coli

Purity

Greater than 96.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Bioactivity

The specific activity as determined by the ability of MCP-4 to chemoattaract human monocytes at 10-100ng/ml, corresponding to a Specific Activity of 10,000-100,000 units/mg.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized MCP-4 in sterile 18M-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized MCP-4 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MCP-4 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Chemokines

Preservative

The protein was lyophilized from a concentrated (1mg/ml) sterile solution in 20mM PB, pH 7.4, 130mM NaCl.

AA Sequence

QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tetromycin B
orb1694345 500 µg

Tetromycin B

Sign In for Pricing
View Details
Syntaxin 19 CRISPR/Cas9 KO Plasmid (m)
sc-426947 20 µg

Syntaxin 19 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Lentiviral human CARD19 shRNA (UAS) - Lentiviral human CARD19 shRNA (UAS, iRFP) (25)
GTR15081938 1 Vial

Lentiviral human CARD19 shRNA (UAS) - Lentiviral human CARD19 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
N'-Hydroxy-2-methyl-3-[5-methyl-3- (trifluoromethyl) -1H-pyrazol-1-yl]propanimidamide
GQB35270-01 250 mg

N'-Hydroxy-2-methyl-3-[5-methyl-3- (trifluoromethyl) -1H-pyrazol-1-yl]propanimidamide

Sign In for Pricing
View Details
N'-Hydroxy-2-methyl-3-[5-methyl-3- (trifluoromethyl) -1H-pyrazol-1-yl]propanimidamide
GQB35270-02 2.5 g

N'-Hydroxy-2-methyl-3-[5-methyl-3- (trifluoromethyl) -1H-pyrazol-1-yl]propanimidamide

Sign In for Pricing
View Details
PML Peptide - middle region (AAP39753)
AAP39753-100UG 100 µg

PML Peptide - middle region (AAP39753)

Sign In for Pricing
View Details