Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MIG Protein

Recombinant of human MIG protein

Product Specifications

Product Name Alternative

Small inducible cytokine B9, CXCL9, Gamma INF-induced monokine, MIG, chemokine (C-X-C motif) ligand 9, CMK, Humig, SCYB9, crg-10, monokine induced by gamma-INF.

Source

Escherichia Coli

Field of Research

Immunology & Inflammation

Purity

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Bioactivity

Determined by its ability to chemoattract human peripheral blood T-Lymphocytes using a concentration range of 10-100ng/ml corresponding to a Specific Activity of 10,000-100,000IU/mg.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized MIG in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized MIG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CXCL9 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Chemokines

Preservative

Lyophilized from a 0.2μm filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 7.4, 50mM NaCl.

AA Sequence

TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B7-H3 Protein, Human, Recombinant (His), Biotinylated
TMPY-04262-01 5 µg

B7-H3 Protein, Human, Recombinant (His), Biotinylated

Sign In for Pricing
View Details
B7-H3 Protein, Human, Recombinant (His), Biotinylated
TMPY-04262-02 10 µg

B7-H3 Protein, Human, Recombinant (His), Biotinylated

Sign In for Pricing
View Details
B7-H3 Protein, Human, Recombinant (His), Biotinylated
TMPY-04262-03 20 µg

B7-H3 Protein, Human, Recombinant (His), Biotinylated

Sign In for Pricing
View Details
B7-H3 Protein, Human, Recombinant (His), Biotinylated
TMPY-04262-04 50 µg

B7-H3 Protein, Human, Recombinant (His), Biotinylated

Sign In for Pricing
View Details
B7-H3 Protein, Human, Recombinant (His), Biotinylated
TMPY-04262-05 100 µg

B7-H3 Protein, Human, Recombinant (His), Biotinylated

Sign In for Pricing
View Details
B7-H3 Protein, Human, Recombinant (His), Biotinylated
TMPY-04262-06 200 µg

B7-H3 Protein, Human, Recombinant (His), Biotinylated

Sign In for Pricing
View Details