Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MIP 5 Protein

Recombinant of human MIP 5 protein

Product Specifications

Product Name Alternative

Small inducible cytokine A15 precursor, CCL15, Macrophage inflammatory protein 5, MIP-5, MIP5, Chemokine CC-2, HCC-2, NCC-3, MIP- 1 delta, Leukotactin-1, LKN-1, Mrp-2b, C-C motif chemokine 15.

Source

Escherichia Coli

Purity

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Bioactivity

Determined by its ability to chemoattract human T-lymphocytes using a concentration range of 1-10 ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized MIP5 in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized MIP-5 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL15 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Chemokines

Preservative

MIP5 was lyophilized from a concentrated (1mg/ml) solution containing 20mM PBS pH-7.4 and 100mM NaCl.

AA Sequence

QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKP GVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MHS4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
28562061 1.0 µg DNA

MHS4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
N-Acetyl-β-Asp-Glu
T2596-01 50 mg

N-Acetyl-β-Asp-Glu

Sign In for Pricing
View Details
N-Acetyl-β-Asp-Glu
T2596-02 1 mL - 10 mM (in DMSO)

N-Acetyl-β-Asp-Glu

Sign In for Pricing
View Details
N-Acetyl-β-Asp-Glu
T2596-03 25 mg

N-Acetyl-β-Asp-Glu

Sign In for Pricing
View Details
Orcein Synthetic
RRBD44-W 25 g

Orcein Synthetic

Sign In for Pricing
View Details
Recombinant Human Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1)
RPU42494-01 50 µg

Recombinant Human Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1)

Sign In for Pricing
View Details