Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MIP 5 Protein

Recombinant of human MIP 5 protein

Product Specifications

Product Name Alternative

Small inducible cytokine A15 precursor, CCL15, Macrophage inflammatory protein 5, MIP-5, MIP5, Chemokine CC-2, HCC-2, NCC-3, MIP- 1 delta, Leukotactin-1, LKN-1, Mrp-2b, C-C motif chemokine 15.

Source

Escherichia Coli

Purity

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Bioactivity

Determined by its ability to chemoattract human T-lymphocytes using a concentration range of 1-10 ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized MIP5 in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized MIP-5 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL15 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Chemokines

Preservative

MIP5 was lyophilized from a concentrated (1mg/ml) solution containing 20mM PBS pH-7.4 and 100mM NaCl.

AA Sequence

QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKP GVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF813 Protein Vector (Human) (pPM-C-HA)
51857021 500 ng

ZNF813 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-human Integrin a2b3 (Tadocizumab Biosimilar)
BIO0776SM-20mg 20 mg

Anti-human Integrin a2b3 (Tadocizumab Biosimilar)

Sign In for Pricing
View Details
HSP40 Rabbit Polyclonal Antibody (BF750)
orb1589162 100 µL

HSP40 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Rat Podocin,Nphs2 ELISA KIT
ELI-03083r 96 Tests

Rat Podocin,Nphs2 ELISA KIT

Sign In for Pricing
View Details
Ddx51 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3541905 3x 1.0 µg

Ddx51 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
LIN28 Polyclonal Antibody
E96034 100 µL

LIN28 Polyclonal Antibody

Sign In for Pricing
View Details