Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TARC Protein

Recombinant of human TARC protein

Product Specifications

Product Name Alternative

C-C motif chemokine 17, Small-inducible cytokine A17, Thymus and activation-regulated chemokine, CC chemokine TARC, ABCD-2, CCL17, CCL-17, SCYA17, TARC, A-152E5.3, MGC138271, MGC138273.

Source

Escherichia Coli

Field of Research

Immunology & Inflammation

Purity

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Bioactivity

Determined by its ability to chemoattract human T-Lymphocytes using a concentration range of 1.0-10.0 ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized CCL17 in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized TARC although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TARC should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Chemokines

Preservative

The protein was lyophilized from a concentrated (0.5mg/ml) solution containing 20mM PBS & 150mM NaCl pH-7.4.

AA Sequence

ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNK RVKNAVKYLQSLERS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAR2 (F-9) : m-IgG1 BP-HRP Bundle
sc-542438 1 Kit

ADAR2 (F-9) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
RDH11 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-6214R-BF555 100 µL

RDH11 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Catsper3 (NM_001106101) Rat Tagged Lenti ORF Clone
RR209699L3 10 µg

Catsper3 (NM_001106101) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CNGA2 peptide
orb217111-01 1 mg

CNGA2 peptide

Sign In for Pricing
View Details
CNGA2 peptide
orb217111-02 5 mg

CNGA2 peptide

Sign In for Pricing
View Details
Mouse IFN-gamma
BP118-500ug 500 µg

Mouse IFN-gamma

Sign In for Pricing
View Details