Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pramlintide peptide

Pramlintide peptide

Product Specifications

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 98.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized Pramlintide in sterile 18MΩ-cm H2O not less than 100 μg/ml, which can then be further diluted to other aqueous solutions. The Pramlintide is also soluble in 1% Acetic Acid.

Storage Conditions

Stability: Lyophilized Pramlintide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Pramlintide should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Hormones

Preservative

The protein was lyophilized with no additives.

AA Sequence

KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-STAT5A  (Tyr694)  Antibody
ABF3305 100 µg

Phospho-STAT5A (Tyr694) Antibody

Sign In for Pricing
View Details
Nalgene CA MF75 1L 0.45um Filter Unit
FIL8052-01 12 / PCK

Nalgene CA MF75 1L 0.45um Filter Unit

Sign In for Pricing
View Details
Nalgene CA MF75 1L 0.45um Filter Unit
FIL8052-02 12 / PCK

Nalgene CA MF75 1L 0.45um Filter Unit

Sign In for Pricing
View Details
Anti-Human ZW10 Antibody Fluoro488 Conjugated
DZ41671-Fluoro488 200 µL/Vial

Anti-Human ZW10 Antibody Fluoro488 Conjugated

Sign In for Pricing
View Details
Etodolac-d4
CS-O-03362 1 Each

Etodolac-d4

Sign In for Pricing
View Details
D19Ertd737e Recombinant Protein (Mouse)
RP127562 100 µg

D19Ertd737e Recombinant Protein (Mouse)

Sign In for Pricing
View Details