Pramlintide peptide
Pramlintide peptide
Product Specifications
Field of Research
Pharmacology & Drug Discovery
Purity
Greater than 98.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized Pramlintide in sterile 18MΩ-cm H2O not less than 100 μg/ml, which can then be further diluted to other aqueous solutions. The Pramlintide is also soluble in 1% Acetic Acid.
Storage Conditions
Stability: Lyophilized Pramlintide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Pramlintide should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles
Notes
For research use only.
Applications Notes
Hormones
Preservative
The protein was lyophilized with no additives.
AA Sequence
KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
226978-FITC 100 µL
Hepatitis B Surface Ag (HBsAg, Hepatitis B Surface) (FITC)
Sign In for Pricing
View Details 