Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pramlintide peptide

Pramlintide peptide

Product Specifications

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 98.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized Pramlintide in sterile 18MΩ-cm H2O not less than 100 μg/ml, which can then be further diluted to other aqueous solutions. The Pramlintide is also soluble in 1% Acetic Acid.

Storage Conditions

Stability: Lyophilized Pramlintide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Pramlintide should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Hormones

Preservative

The protein was lyophilized with no additives.

AA Sequence

KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 Mouse Monoclonal Antibody [Clone ID: OTI3E11]
TA802127S 30 µL

CD4 Mouse Monoclonal Antibody [Clone ID: OTI3E11]

Sign In for Pricing
View Details
IL1RA ELISA Kit (Rabbit)
OKDD04029-48W 48 Tests

IL1RA ELISA Kit (Rabbit)

Sign In for Pricing
View Details
2-Aminocyclopentan-1-one hydrochloride
FAA46416-01 50 mg

2-Aminocyclopentan-1-one hydrochloride

Sign In for Pricing
View Details
2-Aminocyclopentan-1-one hydrochloride
FAA46416-02 0.5 g

2-Aminocyclopentan-1-one hydrochloride

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Methylenetetrahydrofolate Reductase (MTHFR)
MBS2096458-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Methylenetetrahydrofolate Reductase (MTHFR)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Methylenetetrahydrofolate Reductase (MTHFR)
MBS2096458-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Methylenetetrahydrofolate Reductase (MTHFR)

Sign In for Pricing
View Details