Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ME2 Protein

Recombinant of human ME2 protein

Product Specifications

Product Name Alternative

Malic enzyme 2 NAD (+) -dependent mitochondrial, NAD-ME, ODS1, Malate Dehydrogenase, NAD-dependent malic enzyme mitochondrial, pyruvic-malic carboxylase, Malic enzyme 2, EC 1.1.1.38, EC 1.1.1.

Source

Escherichia Coli

Field of Research

Metabolism Research

Purity

Greater than 95.0% as determined by (a) Analysis by HPLC. (b) Analysis by SDS-PAGE.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized ME2 in sterile 18M-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized ME2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution ME2 should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Enzymes

Preservative

The protein was Lyophilized from a 0.2μm filtered concentrated solution in 20mM Tris, 150mM NaCl, 1mM b-mercaptoethanol, 1mM EDTA, pH 8.0.

AA Sequence

MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITEHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Fruit fly Twist Antibody, Dylight550 Conjugate
DZ41509-Dylight550 200 µL

Anti-Fruit fly Twist Antibody, Dylight550 Conjugate

Sign In for Pricing
View Details
Lentiviral human VWDE sgRNA gene knockout kit - Lentiviral human VWDE sgRNA gene knockout kit (100)
GTR15396658 1 Vial

Lentiviral human VWDE sgRNA gene knockout kit - Lentiviral human VWDE sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
FARSB, NT (Phenylalanyl-tRNA synthetase beta chain, Phenylalanine-tRNA ligase beta chain, PheRS, FARSB, FARSLB, FRSB) (Biotin) discontinued
035519-Biotin 200 µL

FARSB, NT (Phenylalanyl-tRNA synthetase beta chain, Phenylalanine-tRNA ligase beta chain, PheRS, FARSB, FARSLB, FRSB) (Biotin) discontinued

Sign In for Pricing
View Details
Mouse Traj50 activation kit by CRISPRa
GA219171 1 Kit

Mouse Traj50 activation kit by CRISPRa

Sign In for Pricing
View Details
Human Uncharacterized protein C9orf153, C9orf153 ELISA KIT
ELI-10275h 96 Tests

Human Uncharacterized protein C9orf153, C9orf153 ELISA KIT

Sign In for Pricing
View Details
FAAP24 Rabbit Polyclonal Antibody (BF488)
orb2512134 100 µL

FAAP24 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details