Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ME2 Protein

Recombinant of human ME2 protein

Product Specifications

Product Name Alternative

Malic enzyme 2 NAD (+) -dependent mitochondrial, NAD-ME, ODS1, Malate Dehydrogenase, NAD-dependent malic enzyme mitochondrial, pyruvic-malic carboxylase, Malic enzyme 2, EC 1.1.1.38, EC 1.1.1.

Source

Escherichia Coli

Field of Research

Metabolism Research

Purity

Greater than 95.0% as determined by (a) Analysis by HPLC. (b) Analysis by SDS-PAGE.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized ME2 in sterile 18M-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized ME2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution ME2 should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Enzymes

Preservative

The protein was Lyophilized from a 0.2μm filtered concentrated solution in 20mM Tris, 150mM NaCl, 1mM b-mercaptoethanol, 1mM EDTA, pH 8.0.

AA Sequence

MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITEHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM13, NT (TRIM13, LEU5, RFP2, RNF77, E3 ubiquitin-protein ligase TRIM13, B Cell chronic lymphocytic leukemia tumor suppressor Leu5, Leukemia-associated protein 5, Putative tumor suppressor RFP2, RING finger protein 77, Ret finger protein 2, Tripartite m
MBS6358152-01 0.1 mL

TRIM13, NT (TRIM13, LEU5, RFP2, RNF77, E3 ubiquitin-protein ligase TRIM13, B Cell chronic lymphocytic leukemia tumor suppressor Leu5, Leukemia-associated protein 5, Putative tumor suppressor RFP2, RING finger protein 77, Ret finger protein 2, Tripartite m

Sign In for Pricing
View Details
TRIM13, NT (TRIM13, LEU5, RFP2, RNF77, E3 ubiquitin-protein ligase TRIM13, B Cell chronic lymphocytic leukemia tumor suppressor Leu5, Leukemia-associated protein 5, Putative tumor suppressor RFP2, RING finger protein 77, Ret finger protein 2, Tripartite m
MBS6358152-02 5x 0.1 mL

TRIM13, NT (TRIM13, LEU5, RFP2, RNF77, E3 ubiquitin-protein ligase TRIM13, B Cell chronic lymphocytic leukemia tumor suppressor Leu5, Leukemia-associated protein 5, Putative tumor suppressor RFP2, RING finger protein 77, Ret finger protein 2, Tripartite m

Sign In for Pricing
View Details
PIGY Overexpression Lysate (Native) - (Dry Ice)
NBP2-05955 0.1 mg

PIGY Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Recombinant Human Leptin Triple Antagonist, Pegylated
7-01191 1 mg

Recombinant Human Leptin Triple Antagonist, Pegylated

Sign In for Pricing
View Details
LBXCOR1 siRNA Oligos set (Human)
61121171 3x 5 nmol

LBXCOR1 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal SPATA4 Antibody [CoraFluor 1]
NBP2-81852CL1 0.1 mL

Rabbit Polyclonal SPATA4 Antibody [CoraFluor 1]

Sign In for Pricing
View Details