Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ME2 Protein

Recombinant of human ME2 protein

Product Specifications

Product Name Alternative

Malic enzyme 2 NAD (+) -dependent mitochondrial, NAD-ME, ODS1, Malate Dehydrogenase, NAD-dependent malic enzyme mitochondrial, pyruvic-malic carboxylase, Malic enzyme 2, EC 1.1.1.38, EC 1.1.1.

Source

Escherichia Coli

Field of Research

Metabolism Research

Purity

Greater than 95.0% as determined by (a) Analysis by HPLC. (b) Analysis by SDS-PAGE.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized ME2 in sterile 18M-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized ME2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution ME2 should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Enzymes

Preservative

The protein was Lyophilized from a 0.2μm filtered concentrated solution in 20mM Tris, 150mM NaCl, 1mM b-mercaptoethanol, 1mM EDTA, pH 8.0.

AA Sequence

MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITEHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RYBP sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2080807 1.0 µg DNA

RYBP sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
MIR3193 Human qPCR Template Standard (MI0014238)
HK300806 200 Reactions

MIR3193 Human qPCR Template Standard (MI0014238)

Sign In for Pricing
View Details
Adlupulone
CS-O-43359 1 Each

Adlupulone

Sign In for Pricing
View Details
Fyb 3'UTR Lenti-reporter-Luc Vector
21102084 1.0 µg

Fyb 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
COX11 Rabbit Polyclonal Antibody
orb2953239-01 50 µg

COX11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
COX11 Rabbit Polyclonal Antibody
orb2953239-02 100 µg

COX11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details