Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ME2 Protein

Recombinant of human ME2 protein

Product Specifications

Product Name Alternative

Malic enzyme 2 NAD (+) -dependent mitochondrial, NAD-ME, ODS1, Malate Dehydrogenase, NAD-dependent malic enzyme mitochondrial, pyruvic-malic carboxylase, Malic enzyme 2, EC 1.1.1.38, EC 1.1.1.

Source

Escherichia Coli

Field of Research

Metabolism Research

Purity

Greater than 95.0% as determined by (a) Analysis by HPLC. (b) Analysis by SDS-PAGE.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized ME2 in sterile 18M-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized ME2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution ME2 should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Enzymes

Preservative

The protein was Lyophilized from a 0.2μm filtered concentrated solution in 20mM Tris, 150mM NaCl, 1mM b-mercaptoethanol, 1mM EDTA, pH 8.0.

AA Sequence

MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITEHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS4P10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2011308 1.0 µg DNA

RPS4P10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
APC anti-human CD8a
GT06953 500 Tests

APC anti-human CD8a

Sign In for Pricing
View Details
TRNAK7 sgRNA CRISPR Lentivector (Human) (Target 2)
K2496203 1.0 µg DNA

TRNAK7 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Mouse Dhcr24 (NM_053272) AAV Particle
MR208301A1V 250 µL

Mouse Dhcr24 (NM_053272) AAV Particle

Sign In for Pricing
View Details
Human Cancer Driver Gene II Primer Library
11150101-1 1 Set

Human Cancer Driver Gene II Primer Library

Sign In for Pricing
View Details
Catenin, beta (p120) Antibody
orb1712003 1 mL

Catenin, beta (p120) Antibody

Sign In for Pricing
View Details