Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PDI Protein

Human recombinant Protein Disulfide Isomerase protein

Product Specifications

Product Name Alternative

Protein Disulfide Isomerase, PDI, EC 5.3.4.1, Prolyl 4-hydroxylase subunit beta, Cellular thyroid hormone-binding protein, p55, P4HB, ERBA2L, PDIA1, PO4DB, DSI, GIT, PHDB, PO4HB, PROHB, P4Hbeta.

Source

Escherichia Coli

Purity

Greater than 95.0% as determined by:a) Analysis by RP-HPLC.b) Analysis by SDS-PAGE.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized PDI in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

References & Citations

Oberčkal, Jernej et al. On the role of protein disulfide isomerase in the retrograde cell transport of secreted phospholipases A2 PLoS One, 10, e0120692 (2015)

Pubmed id

25763817

Storage Conditions

Stability: Lyophilized Protein Disulfide Isomerase although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Human PDI should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please avoid freeze-thaw cycles

Notes

For research use only.

Applications Notes

Reductase Activity: 0.001 650nm/ min-2. By measuring the turbidity increase at 650 nm due to insulin reduction (Holmgren, A. (1979) J. Biol. Chem. 254, 9627–9632) . The activity is expressed as the ratio of the slope of a linear part of the turbidity curve to the lag time (Mart‎ ́nez-Galisteo, E., Padilla, C. A., Garcia-Alfonso, C., Lo ́pez-Barea, J., and Barcena, J. A. (1993) Biochimie (Paris) 75, 803–809) . Isomerase Activity: 0.5 μmol active RNase A min-1 μmol PDI-1. According to the re-activation of reduced and denatured RNase A (Lyles, M. M. and Gilbert, H. F. (1991) Biochemistry 30, 613-619)

Preservative

The PDI protein (1mg/ml) solution was lyophilized from PBS pH-7.

AA Sequence

MRGSGSHHHHHHAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKA AGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVN WLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNS DVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIK THILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITL EEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEK KNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFP ASADRTVIDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQKAVKDEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MICA, Human (179a.a, HEK293, mFc)
HY-P704964 100 µg

MICA, Human (179a.a, HEK293, mFc)

Sign In for Pricing
View Details
Rat Tgfb3 / Transforming growth factor beta-3 Recombinant Protein
R1215r 1 Each

Rat Tgfb3 / Transforming growth factor beta-3 Recombinant Protein

Sign In for Pricing
View Details
ALAD (Delta-aminolevulinic acid dehydratase) BioAssayTM ELISA Kit (Human) discontinued
353819-01 48 Tests

ALAD (Delta-aminolevulinic acid dehydratase) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
ALAD (Delta-aminolevulinic acid dehydratase) BioAssayTM ELISA Kit (Human) discontinued
353819-02 96 Tests

ALAD (Delta-aminolevulinic acid dehydratase) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
Human Serine incorporator 1, SERINC1 ELISA KIT
ELI-39337h 96 Tests

Human Serine incorporator 1, SERINC1 ELISA KIT

Sign In for Pricing
View Details
EDA Polyclonal Antibody, PE-Cy5 Conjugated
bs-12347R-PE-Cy5 100 µL

EDA Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details