Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLA2G2D Protein

Human recombinant Secreted Phospholipase A2-IID protein

Product Specifications

Product Name Alternative

Group IID secretory phospholipase A2, EC 3.1.1.4, Phosphatidylcholine 2-acylhydrolase GIID, GIID sPLA2, PLA2IID, sPLA (2) -IID, Secretory-type PLA, stroma-associated homolog, SPLASH, sPLA2S, PLA2G2D.

Source

Escherichia Coli

Field of Research

Metabolism Research

Purity

Greater than 95.0% as determined by SDS-PAGE.

Form

Sterile Filtered lyophilized (freeze-dried) powder.

Solubility

Add 0.2 ml of 0.1M Acetate buffer pH-4 and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10 μg/ml. In higher concentrations the solubility of this antigen is limited.

Storage Conditions

Stability: Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C

Notes

For research use only.

Applications Notes

Enzymes

Preservative

Sterile filtered and lyophilized from 0.5 mg/ml in 0.05M Acetate buffer pH-4.

AA Sequence

MRGSHHHHHHGMASHMGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGR GQPKDATDWCCQTHDCCYDHLKTQGCGIYKYYRYNFSQGNIHCSDKGSWC EQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SPATS1 Pre-designed siRNA Set B
SI015614B 1 Each

Human SPATS1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
ALDH1B1 Antibody
orb683894 100 µL

ALDH1B1 Antibody

Sign In for Pricing
View Details
Glipr1l2 ORF Vector (Mouse) (pORF)
ORF045562 1.0 µg DNA

Glipr1l2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
PNMA5 Antibody
MBS8502216-01 0.1 mg

PNMA5 Antibody

Sign In for Pricing
View Details
PNMA5 Antibody
MBS8502216-02 0.1 mL (AF405L)

PNMA5 Antibody

Sign In for Pricing
View Details
PNMA5 Antibody
MBS8502216-03 0.1 mL (AF405S)

PNMA5 Antibody

Sign In for Pricing
View Details