Human PLA2G2D Protein
Human recombinant Secreted Phospholipase A2-IID protein
Product Specifications
Product Name Alternative
Group IID secretory phospholipase A2, EC 3.1.1.4, Phosphatidylcholine 2-acylhydrolase GIID, GIID sPLA2, PLA2IID, sPLA (2) -IID, Secretory-type PLA, stroma-associated homolog, SPLASH, sPLA2S, PLA2G2D.
Source
Escherichia Coli
Field of Research
Metabolism Research
Purity
Greater than 95.0% as determined by SDS-PAGE.
Form
Sterile Filtered lyophilized (freeze-dried) powder.
Solubility
Add 0.2 ml of 0.1M Acetate buffer pH-4 and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10 μg/ml. In higher concentrations the solubility of this antigen is limited.
Storage Conditions
Stability: Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C
Notes
For research use only.
Applications Notes
Enzymes
Preservative
Sterile filtered and lyophilized from 0.5 mg/ml in 0.05M Acetate buffer pH-4.
AA Sequence
MRGSHHHHHHGMASHMGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGR GQPKDATDWCCQTHDCCYDHLKTQGCGIYKYYRYNFSQGNIHCSDKGSWC EQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2881435-01 48 Well
Chicken Myeloid differentiation primary response protein MyD88 ELISA Kit
Sign In for Pricing
View Details MBS2881435-02 96 Well
Chicken Myeloid differentiation primary response protein MyD88 ELISA Kit
Sign In for Pricing
View Details MBS2881435-03 5x 96 Well
Chicken Myeloid differentiation primary response protein MyD88 ELISA Kit
Sign In for Pricing
View Details MBS2881435-04 10x 96 Well
Chicken Myeloid differentiation primary response protein MyD88 ELISA Kit
Sign In for Pricing
View Details 