Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PON2 Protein

Recombinant of human PON2 protein

Product Specifications

Product Name Alternative

Serum paraoxonase, arylesterase 2, EC 3.1.1.2, EC 3.1.8.1, PON 2, Serum aryldialkylphosphatase 2, A-esterase 2, Aromatic esterase 2.

Source

Escherichia Coli

Purity

Greater than 95% as determined by SDS-PAGE. Single band on Western Blot.

Form

Sterile Filtered clear solution.

Storage Conditions

Stability: Store at 4°C if entire vial will be used within 1-2 weeks. Store, frozen at -20°C for longer periods of time. Avoid multiple freeze-thaw cycles

Notes

For research use only.

Applications Notes

Applications: Arylesterase 2 can be used directly as a positive control in Western blotting, ELISA, immunoprecipitation and other immunological experiments. The biological activity of this product has not yet been tested

Preservative

PON2 is supplied in PBS and 50% glycerol.

AA Sequence

MGRLVAVGLLGIALALLGERLLALRNRLKASREVESVDLPHCHLIKGIEAGSEDID ILPNGLAFFSVGLKFPGLHSFAPDKPGGILMMDLKEEKPRARELRISRGFDLASFNP HGISTFIDNDDTVYLFVVNHPEFKNTVEIFKFEEAENSLLHLKTVKHELLPSVNDIT AVGPAHFYATNDHYFSDPFLKYLETYLNLHWANVVYYSPNEVKVVAEGFDSAN GINISPDDKYIYVADILAHEIHVLEKHTNMNLTQLKVLELDTLVDNLSIDPSSGDIW VGCHPNGQKLFVYDPNNPPSSEVLRIQNILSEKPTVTTVYANNGSVLQGSSVASVY DGKLLIGTLYHRALYCELZ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen Alpha-1 III Chain Cleaved-Gly1221 (COL3A1 Cleaved-G1221) Antibody
abx323288-01 50 µg

Collagen Alpha-1 III Chain Cleaved-Gly1221 (COL3A1 Cleaved-G1221) Antibody

Sign In for Pricing
View Details
Collagen Alpha-1 III Chain Cleaved-Gly1221 (COL3A1 Cleaved-G1221) Antibody
abx323288-02 100 µg

Collagen Alpha-1 III Chain Cleaved-Gly1221 (COL3A1 Cleaved-G1221) Antibody

Sign In for Pricing
View Details
2-Buten-1-ylsuccinic anhydride
416419-01 100 mg

2-Buten-1-ylsuccinic anhydride

Sign In for Pricing
View Details
2-Buten-1-ylsuccinic anhydride
416419-02 250 mg

2-Buten-1-ylsuccinic anhydride

Sign In for Pricing
View Details
Anti-hIgE mAb (BSW17), 0.1% Na-azide
0910-0-100 1 mg

Anti-hIgE mAb (BSW17), 0.1% Na-azide

Sign In for Pricing
View Details
BeyoIHCTM Type II Cytokeratins Rabbit Monoclonal Antibody
AG8758 50 µL

BeyoIHCTM Type II Cytokeratins Rabbit Monoclonal Antibody

Sign In for Pricing
View Details