What is the catalog number for Human UBE2L3 (His) Protein?

The catalog number for Human UBE2L3 (His) Protein is orb429082.

What sizes are available for Human UBE2L3 (His) Protein?

Human UBE2L3 (His) Protein is available in the following size(s): 10 µg, 50 µg, 1 mg.

How many pack sizes does Human UBE2L3 (His) Protein come in?

Human UBE2L3 (His) Protein is available in 3 different pack sizes.

Is Human UBE2L3 (His) Protein in stock?

Human UBE2L3 (His) Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human UBE2L3 (His) Protein

Recombinant of human UBE2L3 (His) protein

Product Specifications

Product Name Alternative

Ubiquitin-conjugating enzyme E2 L3, EC 6.3.2.19, Ubiquitin-protein ligase L3, Ubiquitin carrier protein L3, UbcH7, E2-F1, L-UBC, UbcM4.

Source

Escherichia Coli

Purity

Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Form

Sterile Filtered white lyophilized powder.

Solubility

It is recommended to reconstitute the lyophilized UBE2L3 in sterile water not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized UBE2L3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution UBE2L3 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Enzymes

Preservative

Lyophilized from a 0.2μm filtered concentrated (1 mg/ml) solution in 1X PBS and 1mM DTT, pH 7.5.

AA Sequence

MHHHHHHAMAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD