Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human UBE2L3 (His) Protein

Recombinant of human UBE2L3 (His) protein

Product Specifications

Product Name Alternative

Ubiquitin-conjugating enzyme E2 L3, EC 6.3.2.19, Ubiquitin-protein ligase L3, Ubiquitin carrier protein L3, UbcH7, E2-F1, L-UBC, UbcM4.

Source

Escherichia Coli

Purity

Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Form

Sterile Filtered white lyophilized powder.

Solubility

It is recommended to reconstitute the lyophilized UBE2L3 in sterile water not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized UBE2L3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution UBE2L3 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Enzymes

Preservative

Lyophilized from a 0.2μm filtered concentrated (1 mg/ml) solution in 1X PBS and 1mM DTT, pH 7.5.

AA Sequence

MHHHHHHAMAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hpcal4 (NM_174998) Mouse Untagged Clone
MC212317 10 µg

Hpcal4 (NM_174998) Mouse Untagged Clone

Sign In for Pricing
View Details
Anti-NK1R Antibody (N188/6)
MBS1571334-01 0.1 mg

Anti-NK1R Antibody (N188/6)

Sign In for Pricing
View Details
Anti-NK1R Antibody (N188/6)
MBS1571334-02 1 mg

Anti-NK1R Antibody (N188/6)

Sign In for Pricing
View Details
Anti-NK1R Antibody (N188/6)
MBS1571334-03 5x 1 mg

Anti-NK1R Antibody (N188/6)

Sign In for Pricing
View Details
Phospho-BRCA1 (Ser988) Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-8444R-APC-Cy5.5 100 µL

Phospho-BRCA1 (Ser988) Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Murashige and Skoog (MS) Medium, Modification No. 4
30630077-3 25 L

Murashige and Skoog (MS) Medium, Modification No. 4

Sign In for Pricing
View Details