Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human p16-INK4a Protein

Recombinant of human p16-INK4a protein

Product Specifications

Product Name Alternative

Cyclin-dependent kinase 4 inhibitor A, CDK4I, p16-INK4, p16-INK4a, p16INK4A, CDKN-2A, CDKN2, Multiple tumor suppressor 1, MTS1, CMM2, MLM, TP16, p16 (INK4), p19.

Source

Escherichia Coli

Field of Research

Cell Biology

Purity

Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized Cyclin-dependent kinase in sterile water not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized Cyclin-dependent kinase although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Cyclin-dependent kinase should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Protein Kinases

Preservative

CDKN2A was lyophilized from a concentrated (1mg/ml) sterile solution containing 1x PBS pH-7.4.

AA Sequence

MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CP-775146
TRC-C781355-1MG 1 mg

CP-775146

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL
BNC740253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB537507 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
2R,3S-Dihydroxy-4-oxo-butanoic Acid (>80%)
TRC-D450800-10MG 10 mg

2R,3S-Dihydroxy-4-oxo-butanoic Acid (>80%)

Sign In for Pricing
View Details
Cytokeratin-17 Antibody
KC-13731-01 50 μL

Cytokeratin-17 Antibody

Sign In for Pricing
View Details
Cytokeratin-17 Antibody
KC-13731-02 100 µL

Cytokeratin-17 Antibody

Sign In for Pricing
View Details