Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantDKK-1, Human

Dickkopf related protein 1 (DKK1) is a chemokine that belongs to the DKK protein family, which alsoincludes DKK-2, DKK-3 and DKK-4. DKK-1 was originally identified as a Xenopus head forming molecule that behaves as an antagonist for Wnt signaling. It is one of the most up-regulated genes during androgen-potentiated balding, with DKK-1 messenger RNA up-regulated a few hours after DHT treatment of hair follicles at the dermal papilla in vitro. Neutralizing bodies against DKK-1 reverses DHT effects on outer root sheath keratinocytes. DKK-1 expression is attenuated by L-threonate, a metabolite of ascorbatein vitro. DKK1 promotes LRP6 internalization and degradation as it forms a ternary complex with the cell surface receptor Kremen. DKK1 not only functions as a head inducer during development, but also regulates joint remodeling and bone formation, which indicate sits role in the pathogenesis of rheumatoid arthritis and multiple myeloma.

Product Specifications

Product Name Alternative

DKK1

Source

Escherichia coli.

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 6 μg/ml, measured in stimulation of alkaline phosphatase activity using CCl-226 cells. Up to 180% stimulation of alkaline phosphatase activity was observed at 10.0 ug/ml.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

17-22 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human DKK1 (rhDKK1) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhDKK1 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEEC GTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIE ETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICK PVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-Off-hsa-miR-193a-5p Vector
mh30279 500 ng

LentimiRa-Off-hsa-miR-193a-5p Vector

Sign In for Pricing
View Details
STK19 (Serine/Threonine-Protein Kinase 19, Serine/Threonine Kinase 19)
493044 100 µL

STK19 (Serine/Threonine-Protein Kinase 19, Serine/Threonine Kinase 19)

Sign In for Pricing
View Details
Dby HY Peptide (608-622), mouse
HY-P5394-01 5 mg

Dby HY Peptide (608-622), mouse

Sign In for Pricing
View Details
Dby HY Peptide (608-622), mouse
HY-P5394-02 10 mg

Dby HY Peptide (608-622), mouse

Sign In for Pricing
View Details
Monkey Calnexin ELISA Kit
MBS7262592-01 48 Well

Monkey Calnexin ELISA Kit

Sign In for Pricing
View Details
Monkey Calnexin ELISA Kit
MBS7262592-02 96 Well

Monkey Calnexin ELISA Kit

Sign In for Pricing
View Details