Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantFGF-21, His, Human

FGF-21, also known as fibroblast growth factor-21 and FGFL, is a secreted growth factor belonging to theheparin-binding growth factor family. It is produced by hepatocytes in response to fatty acid stimulation. FGF-21 couples with its co-factor beta-Klotho to signal through FGFR1c and FGFR4. Signal transduction results in insulin-independent uptake of glucose by adipocytes. Clinical administration of FGF-21 induces energy expenditure, fat utilization and lipid excretion.

Product Specifications

Product Name Alternative

FGF21, fibroblast growth factor-21, FGFL

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50<0.3μg/ml, measured in a bioassay using NIH-3T3 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

23-25kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human FGF-21 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human FGF-21, His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDG ALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDV GSSDPLSMVGPSQGRSPSYASHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apolipoprotein A V Polyclonal Antibody, Biotin Conjugated
bs-5035R-Biotin 100 µL

Apolipoprotein A V Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
anti-Fc epsilon RI
YF-PA23697 50 ul

anti-Fc epsilon RI

Sign In for Pricing
View Details
INPP4A Recombinant Protein
OPCD00656-200UG 200 µg

INPP4A Recombinant Protein

Sign In for Pricing
View Details
Rabbit anti-CCL19 Antibody
MBS4513221-01 0.05 mL

Rabbit anti-CCL19 Antibody

Sign In for Pricing
View Details
Rabbit anti-CCL19 Antibody
MBS4513221-02 0.1 mL

Rabbit anti-CCL19 Antibody

Sign In for Pricing
View Details
Rabbit anti-CCL19 Antibody
MBS4513221-03 5x 0.1 mL

Rabbit anti-CCL19 Antibody

Sign In for Pricing
View Details