Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Leukemia inhibitory factor (Lif)

Product Specifications

Product Name Alternative

LIF; Differentiation-stimulating factor (D factor)

Abbreviation

Recombinant Mouse Lif protein

Gene Name

Lif

UniProt

P09056

Expression Region

24-203aa

Organism

Mus musculus (Mouse)

Target Sequence

SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Cancer

Relevance

LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR52A4 Antibody
OAAJ05907-100UL 100 µL

OR52A4 Antibody

Sign In for Pricing
View Details
Nat8b AAV siRNA Pooled Vector
31480166 1.0 µg

Nat8b AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Cox8a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7006507 1.0 µg DNA

Cox8a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
WYE-125132 (WYE-132)
C16980-50mg 50 mg

WYE-125132 (WYE-132)

Sign In for Pricing
View Details
STK33, CT (Serine/Threonine-protein Kinase 33) (AP)
MBS6500205-01 0.2 mL

STK33, CT (Serine/Threonine-protein Kinase 33) (AP)

Sign In for Pricing
View Details
STK33, CT (Serine/Threonine-protein Kinase 33) (AP)
MBS6500205-02 5x 0.2 mL

STK33, CT (Serine/Threonine-protein Kinase 33) (AP)

Sign In for Pricing
View Details