Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantI-309/CCL1, Human (CHO-expressed)

Chemokine (C-C motif) ligand 1 (CCL1), also known as I-309, is a small glycoprotein secreted by activated T cells that belongs to the family of chemokines. Human CCL1 has been assumed to be a homologue of mouse TCA3. While the two proteins share only approximately 42% amino acid sequence identity, both chemokines contain an extra pair of cysteine residues not found in most other chemokines. CCL1 attracts monocytes, NK cells, immature B cells and dendritic cells by interacting with the cell surface chemokine receptor CCR8. This chemokine resides in a large cluster of CC chemokines on human chromosome 17.Recombinant Human I-309/CCL1 produced in CHO cells is a polypeptide chain containing 73 amino acids. A fully biologically active molecule, rhI-309/CCL1 has a molecular mass of 15kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

Product Name Alternative

CCL1, TCA-3

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 98% as analyzed by SDS-PAGE.

Bioactivity

The EC50 value of human I-309/CCL1 on Caˆ2+ mobilization assay in CHO-K1/ G15/hCCR8 cells (human G15 and human CCR8 stably expressed in CHO-K1 cells) is less than 1 μg/ml.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

15 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human I-309°CCL1 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, recombinant human I-309°CCL1 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQR HRKMLRHCPSKRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camel Glutathione Peroxidase (GSH-PX) ELISA Kit
EK10394 48 Tests

Camel Glutathione Peroxidase (GSH-PX) ELISA Kit

Sign In for Pricing
View Details
Anti-Heart Failure Agent 2
orb3141894-01 10 mg

Anti-Heart Failure Agent 2

Sign In for Pricing
View Details
Anti-Heart Failure Agent 2
orb3141894-02 50 mg

Anti-Heart Failure Agent 2

Sign In for Pricing
View Details
ATTO 532 maleimide
orb2566920-01 50 mg

ATTO 532 maleimide

Sign In for Pricing
View Details
ATTO 532 maleimide
orb2566920-02 100 mg

ATTO 532 maleimide

Sign In for Pricing
View Details
ATTO 532 maleimide
orb2566920-03 25 mg

ATTO 532 maleimide

Sign In for Pricing
View Details