Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantI-309/CCL1, Human (CHO-expressed)

Chemokine (C-C motif) ligand 1 (CCL1), also known as I-309, is a small glycoprotein secreted by activated T cells that belongs to the family of chemokines. Human CCL1 has been assumed to be a homologue of mouse TCA3. While the two proteins share only approximately 42% amino acid sequence identity, both chemokines contain an extra pair of cysteine residues not found in most other chemokines. CCL1 attracts monocytes, NK cells, immature B cells and dendritic cells by interacting with the cell surface chemokine receptor CCR8. This chemokine resides in a large cluster of CC chemokines on human chromosome 17.Recombinant Human I-309/CCL1 produced in CHO cells is a polypeptide chain containing 73 amino acids. A fully biologically active molecule, rhI-309/CCL1 has a molecular mass of 15kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

Product Name Alternative

CCL1, TCA-3

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 98% as analyzed by SDS-PAGE.

Bioactivity

The EC50 value of human I-309/CCL1 on Caˆ2+ mobilization assay in CHO-K1/ G15/hCCR8 cells (human G15 and human CCR8 stably expressed in CHO-K1 cells) is less than 1 μg/ml.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

15 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human I-309°CCL1 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, recombinant human I-309°CCL1 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQR HRKMLRHCPSKRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubd sgRNA CRISPR Lentivector (Rat) (Target 2)
K6884903 1.0 µg DNA

Ubd sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
PLA2G2A siRNA (Rat)
MBS8217248-01 15 nmol

PLA2G2A siRNA (Rat)

Sign In for Pricing
View Details
PLA2G2A siRNA (Rat)
MBS8217248-02 30 nmol

PLA2G2A siRNA (Rat)

Sign In for Pricing
View Details
PLA2G2A siRNA (Rat)
MBS8217248-03 5x 30 nmol

PLA2G2A siRNA (Rat)

Sign In for Pricing
View Details
CDC25C antibody
10R-1350 100 ug

CDC25C antibody

Sign In for Pricing
View Details
Canine tumor necrosis factor receptor superfamily member 17 Elisa kit
GTR10431990 96 Well

Canine tumor necrosis factor receptor superfamily member 17 Elisa kit

Sign In for Pricing
View Details