Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-7, His, Mouse

Interleukin-7 (IL-7), also known as lymphopoietin 1 and pre-B cell factor, is a hematopoietic growth factor belonging to the IL-7/IL-9 family. It is produced by keratinocytes, dendritic cells, hepatocytes, neurons and epithelial cells. IL-7 binds and signals through IL-7 receptor, a heterodimer consisting of IL-7 receptor alpha and common gamma chain receptor.IL-7 plays a role in regulating early B cell and T cell development. It is also important for optimal dendritic cell-T cell interaction.

Product Specifications

Product Name Alternative

Interleukin-7, IL7

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50<0.4ng/ml, measured in a cell proliferation assay using 2E8 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

8-28kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant murine Interleukin-7 (IL-7), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine Interleukin-7 (IL-7), His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLN RAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSIHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFPL1 Antibody - C-terminal region
MBS3220397-01 0.1 mL

RFPL1 Antibody - C-terminal region

Sign In for Pricing
View Details
RFPL1 Antibody - C-terminal region
MBS3220397-02 5x 0.1 mL

RFPL1 Antibody - C-terminal region

Sign In for Pricing
View Details
DHX32 sgRNA CRISPR Lentivector (Human) (Target 2)
K0600803 1.0 µg DNA

DHX32 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Recombinant Novosphingobium aromaticivorans Methylenetetrahydrofolate--tRNA- (uracil-5-) -methyltransferase TrmFO (trmFO)
MBS1296066-01 0.02 mg (E-Coli)

Recombinant Novosphingobium aromaticivorans Methylenetetrahydrofolate--tRNA- (uracil-5-) -methyltransferase TrmFO (trmFO)

Sign In for Pricing
View Details
Recombinant Novosphingobium aromaticivorans Methylenetetrahydrofolate--tRNA- (uracil-5-) -methyltransferase TrmFO (trmFO)
MBS1296066-02 0.02 mg (Yeast)

Recombinant Novosphingobium aromaticivorans Methylenetetrahydrofolate--tRNA- (uracil-5-) -methyltransferase TrmFO (trmFO)

Sign In for Pricing
View Details
Recombinant Novosphingobium aromaticivorans Methylenetetrahydrofolate--tRNA- (uracil-5-) -methyltransferase TrmFO (trmFO)
MBS1296066-03 0.1 mg (E-Coli)

Recombinant Novosphingobium aromaticivorans Methylenetetrahydrofolate--tRNA- (uracil-5-) -methyltransferase TrmFO (trmFO)

Sign In for Pricing
View Details