Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-7, His, Mouse

Interleukin-7 (IL-7), also known as lymphopoietin 1 and pre-B cell factor, is a hematopoietic growth factor belonging to the IL-7/IL-9 family. It is produced by keratinocytes, dendritic cells, hepatocytes, neurons and epithelial cells. IL-7 binds and signals through IL-7 receptor, a heterodimer consisting of IL-7 receptor alpha and common gamma chain receptor.IL-7 plays a role in regulating early B cell and T cell development. It is also important for optimal dendritic cell-T cell interaction.

Product Specifications

Product Name Alternative

Interleukin-7, IL7

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50<0.4ng/ml, measured in a cell proliferation assay using 2E8 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

8-28kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant murine Interleukin-7 (IL-7), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine Interleukin-7 (IL-7), His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLN RAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSIHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caprine Inhibin Subunit Alpha (INHA) ELISA Kit-Sandwich
EK3F445-01 48 Test

Caprine Inhibin Subunit Alpha (INHA) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Caprine Inhibin Subunit Alpha (INHA) ELISA Kit-Sandwich
EK3F445-02 96 Tests

Caprine Inhibin Subunit Alpha (INHA) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) SAC5 Polyclonal Antibody
MBS9017203 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) SAC5 Polyclonal Antibody

Sign In for Pricing
View Details
FAM193B Protein Vector (Mouse) (pPB-C-His)
PV177698 500 ng

FAM193B Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
GSK269962A
S7512-1g 1 g

GSK269962A

Sign In for Pricing
View Details
LYVE1 (N-term) Rabbit Polyclonal Antibody
AP11874PU-N 400 µL

LYVE1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details