Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantOTOR, Human

OTOR, also called Otoraplin and MIAL, is a secreted cytokine and a member of the melanoma-inhibiting activity gene family. Members of this family which also includes MIA, MIA2, and TANGO share a SRC homology-3 (SH3) -like domain. OTOR appears to be involved in early chondrogenesis of the otic capsule, which is required for normal inner ear development and auditory function. OTOR is highly homologous to MIA/cartilage-derived retinoic acid-sensitive protein (CD-RAP), which is a cartilage-specific protein that is also expressed in malignant melanoma cells. The 111 amino acid mature human otoraplin contains 1 SH3 domain (46-107 amino acids) and a Tyr at position 50 that is reportedly sulfated. Otoraplin takes part in the initiation of periotic mesenchyme chondrogenesis. Recombinant human Otoraplin (OTOR) produced in CHO cells is a single non-glycosylated polypeptide chain containing 111 amino acids. A fully biologically active molecule, rhOTOR has a molecular mass of 14-15 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

Product Name Alternative

Otoraplin, Fibrocyte-derived protein, Melanoma inhibitory activity-like protein, OTOR, MIAL, FDP, MIAL1

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

Data Not Available.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

14-15 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human Otoraplin (OTOR) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human Otoraplin (OTOR) should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENG AGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRK1, CT (G-Protein-coupled Receptor Kinase 1, GPRK1, Rhodopsin Kinase, RHOK, RK) (Azide free) (HRP)
MBS6478994-01 0.2 mL

GRK1, CT (G-Protein-coupled Receptor Kinase 1, GPRK1, Rhodopsin Kinase, RHOK, RK) (Azide free) (HRP)

Sign In for Pricing
View Details
GRK1, CT (G-Protein-coupled Receptor Kinase 1, GPRK1, Rhodopsin Kinase, RHOK, RK) (Azide free) (HRP)
MBS6478994-02 5x 0.2 mL

GRK1, CT (G-Protein-coupled Receptor Kinase 1, GPRK1, Rhodopsin Kinase, RHOK, RK) (Azide free) (HRP)

Sign In for Pricing
View Details
MOCS3 Antibody, HRP conjugated
CSB-PA014707LB01HU-01 50 μL

MOCS3 Antibody, HRP conjugated

Sign In for Pricing
View Details
MOCS3 Antibody, HRP conjugated
CSB-PA014707LB01HU-02 100 µL

MOCS3 Antibody, HRP conjugated

Sign In for Pricing
View Details
EGFR (phospho Thr693) Polyclonal Antibody
MBS8519861-01 0.1 mg

EGFR (phospho Thr693) Polyclonal Antibody

Sign In for Pricing
View Details
EGFR (phospho Thr693) Polyclonal Antibody
MBS8519861-02 0.1 mL (AF635)

EGFR (phospho Thr693) Polyclonal Antibody

Sign In for Pricing
View Details