Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantVEGF165, Rat (CHO-expressed)

Vascular Endothelial Growth Factor (VEGF) is a potent growth and angiogenic cytokine. It stimulates proliferation and survival of endothelial cells, and promotes angiogenesis and vascular permeability. Expressed in vascularized tissues, Vascular Endothelial Growth Factor (VEGF) plays a prominent role in normal and pathological angiogenesis. Substantial evidence implicates Vascular Endothelial Growth Factor (VEGF) in the induction of tumor metastasis and intra-ocular neovascular syndromes. Vascular Endothelial Growth Factor (VEGF) signals through the three receptors; fms-like tyrosine kinase (flt-1), KDR gene product (the murine homolog of KDR is the flk-1 gene product) and the flt4 gene product.

Product Specifications

Product Name Alternative

Vascular Endothelial Growth Factor, VPF, Folliculostellate cell-derived growth factor, Glioma-derived endothelial cell mitogen

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 2.5 x 10ˆ5 units/mg

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

35-48 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat Vascular Endothelial Growth Factor 165 (VEGF165) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rrVEGF165 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIM RIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCD KPRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (Membrane Metalloendopeptidase) (MME/1870), CF740 conjugate, 0.1mg/mL
BNC741870-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/1870), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tpsab1 Mouse Gene Knockout Kit (CRISPR)
KN518108 1 Kit

Tpsab1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FITC Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185UC-01 25 µg

FITC Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details
FITC Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185UC-02 100 µg

FITC Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details
HSP27 (Heat Shock Protein 27) (rHSPB1/774), CF740 conjugate, 0.1mg/mL
BNC742308-100 1x 100 µL

HSP27 (Heat Shock Protein 27) (rHSPB1/774), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACADM Mouse Monoclonal Antibody [Clone ID: OTI9G10]
CF811769 100 µg

ACADM Mouse Monoclonal Antibody [Clone ID: OTI9G10]

Sign In for Pricing
View Details