Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIFN-β, Human

Interferon-beta (IFN-β), acting via STAT1 and STAT2, is known to upregulate and downregulate a wide variety of genes, most of which are involved in the antiviral immune response. It is a member of Type I IFNs, which include IFN-α, -β, τ, and –ω. IFN-β plays an important role in inducing non-specific resistance against a broad range of viral infections. It also affects cell proliferation and modulates immune responses.

Product Specifications

Product Name Alternative

Leukocyte interferon, B cell interferon, Type I interferon

Source

HEK 293

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 0.1 ng/ml, measured in a proliferation assay using TF-1 Cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

~23 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Interferon-beta remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interferon-beta should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWN ETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRL TGYLRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGC105567 Rat shRNA Lentiviral Particle (Locus ID 498873)
TL702566V 500 µL Each

MGC105567 Rat shRNA Lentiviral Particle (Locus ID 498873)

Sign In for Pricing
View Details
NGB Polyclonal Antibody
JOT-AP05844-01 20 µL

NGB Polyclonal Antibody

Sign In for Pricing
View Details
NGB Polyclonal Antibody
JOT-AP05844-02 50 μL

NGB Polyclonal Antibody

Sign In for Pricing
View Details
NGB Polyclonal Antibody
JOT-AP05844-03 100 µL

NGB Polyclonal Antibody

Sign In for Pricing
View Details
STRAP Polyclonal Antibody
MBS9125494-01 0.02 mL

STRAP Polyclonal Antibody

Sign In for Pricing
View Details
STRAP Polyclonal Antibody
MBS9125494-02 0.1 mL

STRAP Polyclonal Antibody

Sign In for Pricing
View Details