Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human H2AFX Protein

This Human H2AFX Protein spans the amino acid sequence from region 12-141aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H2A.X

UniProt

P16104

Expression Region

12-141aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF2D Protein Vector (Human) (pPM-C-HA)
PV075147 500 ng

EIF2D Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Rat CD44H Antibody
JOT22904F 20Tests

PE/Cyanine7 Anti-Rat CD44H Antibody

Sign In for Pricing
View Details
Dextran sulfate 40 sodium salt for biochemistry
1138GR250 250 g

Dextran sulfate 40 sodium salt for biochemistry

Sign In for Pricing
View Details
Clindamycin 2-Phosphate Sulfoxide Isomer A
CS-O-33317 1 Each

Clindamycin 2-Phosphate Sulfoxide Isomer A

Sign In for Pricing
View Details
Nori® Porcine 2-Plex ELISA Kits-IL6/IL8
GR224043 96 Well

Nori® Porcine 2-Plex ELISA Kits-IL6/IL8

Sign In for Pricing
View Details
NR2F1 Protein, Human, Recombinant (His)
TMPH-01157-01 5 µg

NR2F1 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details