Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNTNAP2 Protein

This CNTNAP2 Protein spans the amino acid sequence from region 35-181aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cell recognition molecule Caspr2

UniProt

Q5RD64

Expression Region

35-181aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CDEPLVSGLPHGAFSSSSSISGSYSPGYAKINKRGGAGGWSPSDSDHYQWLQVDFGNRKQISAIATQGRYSSSDWVTQYRMLYSDTGRNWKPYHQDGNIWAFPGNINSDGVVRHELQHPVIARYVRVVPLDWNGEGRIGLRIEVYGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VRK3 Antibody
orb379967 100 µL

VRK3 Antibody

Sign In for Pricing
View Details
PI3 AAV siRNA Pooled Vector
36624161 1.0 µg

PI3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
BAMBI Antibody
E96532 100 µL

BAMBI Antibody

Sign In for Pricing
View Details
SAP155 (SF3B1) (NM_001005526) Human Over-expression Lysate
LS023451-100ug 100 µg

SAP155 (SF3B1) (NM_001005526) Human Over-expression Lysate

Sign In for Pricing
View Details
CCL2 ELISA Kit (Human) : 96 Wells (OKEH00157)
OKEH00157 96 Well

CCL2 ELISA Kit (Human) : 96 Wells (OKEH00157)

Sign In for Pricing
View Details
Ldoc1 3'UTR Lenti-reporter-Luc Vector
26423084 1.0 µg

Ldoc1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details