Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNTNAP2 Protein

This CNTNAP2 Protein spans the amino acid sequence from region 35-181aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cell recognition molecule Caspr2

UniProt

Q5RD64

Expression Region

35-181aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CDEPLVSGLPHGAFSSSSSISGSYSPGYAKINKRGGAGGWSPSDSDHYQWLQVDFGNRKQISAIATQGRYSSSDWVTQYRMLYSDTGRNWKPYHQDGNIWAFPGNINSDGVVRHELQHPVIARYVRVVPLDWNGEGRIGLRIEVYGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEF2BNB Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV643854 1.0 µg DNA

MEF2BNB Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
FGF-17, Human
MBS8575263-01 0.005 mg

FGF-17, Human

Sign In for Pricing
View Details
FGF-17, Human
MBS8575263-02 5x 0.005 mg

FGF-17, Human

Sign In for Pricing
View Details
YPEL5 Recombinant Protein (Human)
RP108056 100 µg

YPEL5 Recombinant Protein (Human)

Sign In for Pricing
View Details
Human NG2/MCSP Alexa Fluor 700 Antibody (Clone 7.1)
FAB25851N-100UG 100 µg

Human NG2/MCSP Alexa Fluor 700 Antibody (Clone 7.1)

Sign In for Pricing
View Details
Human Arachidonic Acid (AA) Elisa Kit
EK700335 96 Well

Human Arachidonic Acid (AA) Elisa Kit

Sign In for Pricing
View Details