Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KIR2DL5B Protein

This Human KIR2DL5B Protein spans the amino acid sequence from region 22-238aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(CD158 antigen-like family member F2) (Killer cell immunoglobulin-like receptor 2DLX) (CD antigen CD158f2)

UniProt

Q8NHK3

Expression Region

22-238aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVDGTFQADFPLGPATHGGTYTCFSSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC6A3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2160507 1.0 µg DNA

SLC6A3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Anti-CD28 Antibody [CD28.2], FITC-100Tests
QAB37-F-100Tests 100Tests

Anti-CD28 Antibody [CD28.2], FITC-100Tests

Sign In for Pricing
View Details
(Alextatug) Biosimilar Reference Antibody
orb3158293-01 100 µg

(Alextatug) Biosimilar Reference Antibody

Sign In for Pricing
View Details
(Alextatug) Biosimilar Reference Antibody
orb3158293-02 1 mg

(Alextatug) Biosimilar Reference Antibody

Sign In for Pricing
View Details
(Alextatug) Biosimilar Reference Antibody
orb3158293-03 5 mg

(Alextatug) Biosimilar Reference Antibody

Sign In for Pricing
View Details
(Alextatug) Biosimilar Reference Antibody
orb3158293-04 10 mg

(Alextatug) Biosimilar Reference Antibody

Sign In for Pricing
View Details