Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NR4A1 Protein

This Human NR4A1 Protein spans the amino acid sequence from region 1-598aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Early response protein NAK1) (Nuclear hormone receptor NUR/77) (Nur77) (Orphan nuclear receptor HMR) (Orphan nuclear receptor TR3) (ST-59) (Testicular receptor 3)

UniProt

P22736

Expression Region

1-598aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

69.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCTD14 Rabbit Polyclonal Antibody (Biotin)
orb450588 100 µL

KCTD14 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Human Dynorphin A LISA kit ELISA Kit
GTR10362995 96 Well

Human Dynorphin A LISA kit ELISA Kit

Sign In for Pricing
View Details
Glycoprotein antibody
70R-6282 100 µL

Glycoprotein antibody

Sign In for Pricing
View Details
Recombinant Psychrobacter cryohalolentis tRNA modification GTPase MnmE (mnmE)
MBS1386370-01 0.02 mg (E-Coli)

Recombinant Psychrobacter cryohalolentis tRNA modification GTPase MnmE (mnmE)

Sign In for Pricing
View Details
Recombinant Psychrobacter cryohalolentis tRNA modification GTPase MnmE (mnmE)
MBS1386370-02 0.02 mg (Yeast)

Recombinant Psychrobacter cryohalolentis tRNA modification GTPase MnmE (mnmE)

Sign In for Pricing
View Details
Recombinant Psychrobacter cryohalolentis tRNA modification GTPase MnmE (mnmE)
MBS1386370-03 0.1 mg (E-Coli)

Recombinant Psychrobacter cryohalolentis tRNA modification GTPase MnmE (mnmE)

Sign In for Pricing
View Details