Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Avian infectious bronchitis virus Non-structural protein 5a Protein

This Avian infectious bronchitis virus Non-structural protein 5a Protein spans the amino acid sequence from region 1-65aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(ns5a) (Accessory protein 5a)

UniProt

Q5I5X4

Expression Region

1-65aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Avian infectious bronchitis virus (strain M41) (IBV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKWLTSFVRAVISCYKPLLLTQLRVLDRLILDHGPKHILTCVRCVILFQLDLVYRLAYTPTQSLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CP045, ID (C16orf45, Uncharacterized protein C16orf45) (AP)
MBS6288186-01 0.2 mL

CP045, ID (C16orf45, Uncharacterized protein C16orf45) (AP)

Sign In for Pricing
View Details
CP045, ID (C16orf45, Uncharacterized protein C16orf45) (AP)
MBS6288186-02 5x 0.2 mL

CP045, ID (C16orf45, Uncharacterized protein C16orf45) (AP)

Sign In for Pricing
View Details
Complete Medium for Human Uveal Melanoma Cells
abx703847 500 mL

Complete Medium for Human Uveal Melanoma Cells

Sign In for Pricing
View Details
4-Bromo-2-chloro-6- (difluoromethyl) pyridine
GXC78085-01 100 mg

4-Bromo-2-chloro-6- (difluoromethyl) pyridine

Sign In for Pricing
View Details
4-Bromo-2-chloro-6- (difluoromethyl) pyridine
GXC78085-02 250 mg

4-Bromo-2-chloro-6- (difluoromethyl) pyridine

Sign In for Pricing
View Details
Recombinant Frog virus 3 Early 31 kDa protein
MBS1143611-01 0.02 mg (E-Coli)

Recombinant Frog virus 3 Early 31 kDa protein

Sign In for Pricing
View Details