Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL33 Protein

This IL33 Protein spans the amino acid sequence from region 102-263aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IL-33) (Protein DVS27)

UniProt

O97863

Expression Region

102-263aa

Tag

N-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CFGRANVPSIQEYSASLSTYNDQSITFVFEDGSYEIYVEDLRKGQEKDKVLFRYYDSQSPSHETGDDVDGQTLLVNLSPTKDKDFLLHANNEEHSVELQKCENQLPDQAFFLLHRKSSECVSFECKNNPGVFIGVKDNHLALIKVGDQTKDSYIEKTIFKLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAb604.107
T9901A-1601-01 1 mg

MAb604.107

Sign In for Pricing
View Details
MAb604.107
T9901A-1601-02 5 mg

MAb604.107

Sign In for Pricing
View Details
Cecropin A (1-8) -Melittin (1-18) amide
FC109238-01 2000 µg

Cecropin A (1-8) -Melittin (1-18) amide

Sign In for Pricing
View Details
Cecropin A (1-8) -Melittin (1-18) amide
FC109238-02 5000 μg

Cecropin A (1-8) -Melittin (1-18) amide

Sign In for Pricing
View Details
Cecropin A (1-8) -Melittin (1-18) amide
FC109238-03 10000 μg

Cecropin A (1-8) -Melittin (1-18) amide

Sign In for Pricing
View Details
Wdyhv1 3'UTR Luciferase Stable Cell Line
TU122280 1.0 mL

Wdyhv1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details