Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human UGT2B17 Protein

This Human UGT2B17 Protein spans the amino acid sequence from region 24-530aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(UDPGT 2B17) (UGT2B17) (C19-steroid-specific UDP-glucuronosyltransferase) (C19-steroid-specific UDPGT)

UniProt

O75795

Expression Region

24-530aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

64.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GKVLVWPTEYSHWINMKTILEELVQRGHEVIVLTSSASILVNASKSSAIKLEVYPTSLTKNDLEDFFMKMFDRWTYSISKNTFWSYFSQLQELCWEYSDYNIKLCEDAVLNKKLMRKLQESKFDVLLADAVNPCGELLAELLNIPFLYSLRFSVGYTVEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIYMLYFDFWFQAYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTMSSRDLLNALKSVINDPIYKENIMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYHSLDVIAFLLACVATMIFMITKCCLFCFRKLAKTGKKKKRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AIP4 HDR Plasmid (h)
sc-401677-HDR 20 µg

AIP4 HDR Plasmid (h)

Sign In for Pricing
View Details
ATG3P CRISPR Knock Out 293T Cell Line (Human)
53098141 1x 10^6 Cells / 1.0 mL

ATG3P CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Cavy Eukaryotic Translation Initiation Factor 6 ELISA Kit
MBS073450 Inquire

Cavy Eukaryotic Translation Initiation Factor 6 ELISA Kit

Sign In for Pricing
View Details
Recombinant Chicken Hemoglobin subunit rho
MBS1226007-01 0.02 mg (E-Coli)

Recombinant Chicken Hemoglobin subunit rho

Sign In for Pricing
View Details
Recombinant Chicken Hemoglobin subunit rho
MBS1226007-02 0.1 mg (E-Coli)

Recombinant Chicken Hemoglobin subunit rho

Sign In for Pricing
View Details
Recombinant Chicken Hemoglobin subunit rho
MBS1226007-03 0.02 mg (Yeast)

Recombinant Chicken Hemoglobin subunit rho

Sign In for Pricing
View Details