Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TFPI Protein

This Human TFPI Protein spans the amino acid sequence from region 29-282aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(TFPI) (Extrinsic pathway inhibitor) (EPI) (Lipoprotein-associated coagulation inhibitor) (LACI)

UniProt

P10646

Expression Region

29-282aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human TFPI at 1 μg/mL can bind Anti-TFPI recombinant antibody, the EC50 is 1.242-1.788 ng/mL.

Form

Lyophilized powder

Molecular Weight

31.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF302 Antibody
OAGA06797-100UL 100 µL

ZNF302 Antibody

Sign In for Pricing
View Details
AR Antibody, FITC conjugated
A41403-50UG 50 µg

AR Antibody, FITC conjugated

Sign In for Pricing
View Details
SEA Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV748133 1.0 µg DNA

SEA Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
TAPSO
T65449 10 g

TAPSO

Sign In for Pricing
View Details
(S) -tert-Butyl 2- ((2- (4-bromophenyl) -2-oxoethyl) carbamoyl) pyrrolidine-1-carboxylate
OR1054090 250 mg

(S) -tert-Butyl 2- ((2- (4-bromophenyl) -2-oxoethyl) carbamoyl) pyrrolidine-1-carboxylate

Sign In for Pricing
View Details
Rabphilin-3A (m) : 293T Lysate
sc-122930 100 µg - 200 µL

Rabphilin-3A (m) : 293T Lysate

Sign In for Pricing
View Details