Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human REG3G Protein

This Human REG3G Protein spans the amino acid sequence from region 27-175aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(REG-3-gamma) (Pancreatitis-associated protein 1B) (PAP-1B) (Pancreatitis-associated protein IB) (PAP IB) (Regenerating islet-derived protein III-gamma) (REG III) (Reg III-gamma)

UniProt

Q6UW15

Expression Region

27-175aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEPTIN4 Human Over-expression Lysate
orb1356093 100 µg

SEPTIN4 Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Plin3 Antibody (C-term)
MBS9207741-01 0.08 mL

Mouse Plin3 Antibody (C-term)

Sign In for Pricing
View Details
Mouse Plin3 Antibody (C-term)
MBS9207741-02 0.4 mL

Mouse Plin3 Antibody (C-term)

Sign In for Pricing
View Details
Mouse Plin3 Antibody (C-term)
MBS9207741-03 5x 0.4 mL

Mouse Plin3 Antibody (C-term)

Sign In for Pricing
View Details
LIS1 Rabbit Polyclonal Antibody (FITC)
orb15926 100 µL

LIS1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Recombinant Bovine Rhodopsin (RHO)
MBS7028560-01 0.02 mg (E-Coli)

Recombinant Bovine Rhodopsin (RHO)

Sign In for Pricing
View Details